Hubei Cangsheng Trading Co., Ltd.

Turinabol,Proviron,Winstrol,Oxandrolone,Primobolan,Masteron,Trenbolone Enanthate,Trenbolone Acetate,Equipose, HGH,Sarms,Peptides...

Product Certification

Hubei Cangsheng Trading Co., Ltd.

Country:China (Mainland)

Business Type:Trading Company

Assessed supplierAssessed
supplier

    x
  • Ms.Eunice

Products Categories

Contacts

  • Ms.Bella
    Tel: +86 19971437628

  • Fax:
  • URL: http://
  • Province/state: Hubei
  • City: Jingzhou
  • Street:Kenxin Road, People's Courtyard Farm Management Area, Jianli County, Jingzhou City, Hubei Province
E-MAIL Supplier    Clike here
Home > Products > 

CJC-1295 With DAC Peptide Muscle Gaining CJC-1295 without DAC 99% Assay Quick Effect USP Standard

CJC-1295 With DAC Peptide Muscle Gaining CJC-1295 without DAC 99% Assay Quick Effect USP Standard CAS NO.863288-34-0

  • FOB Price: USD: 10.00-10.00 /Gram Get Latest Price
  • Min.Order: 10 Gram
  • Payment Terms: T/T,Other
  • Available Specifications:

    99%(10-100000000)Gram

  • Product Details

Keywords

  • CJC-1295 high purity lyophilized powder
  • High purity powder HGH
  • Fitness, weight loss, muscle building

Quick Details

  • ProName: CJC-1295 without DAC
  • CasNo: 863288-34-0
  • Molecular Formula: C152H252N44O42
  • Appearance: lyophilized powder
  • Application: Fitness
  • DeliveryTime: 7-15days
  • PackAge: Concealed packaging
  • Port: Hong Kong
  • ProductionCapacity: 10000000 box/
  • Purity: 99%
  • Storage: Low-temperature storage
  • Transportation: Air transport, sea transport
  • LimitNum: 10 Gram

Superiority

Hubei Cangsheng Trading Co., Ltd is a quality China supplier of steroids raw powder, anabolics body’building materials, fitness supplement hormones, muscle gain raw steroids, weight loss raw powder,anti-estrogen hormones powder, and peptides.

we serve over 50 countries' customers with high reputation, high quality, reasonable price, and safe shipping are our keys to serve the customers to establish a long-term and stable cooperation relationship with customers in the world.

Details

Purity: 99

Appearance:White powder

Packaging & Delivery

Packaging Detail: 5mg

Brand: Cangsheng

Delivery Detail:

Detailed Description

Name: cjc1295
Synonyms: CJC-1295(2MG); CJC-1295 Acetate; CJC-1295 CJC-1295; CJC1295 with out DAC; eucylserylargininamide; rtylisoleucylleucylseryl-; CJC-1295/CJC1-295(WITHOUT DAC); Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
CAS Registry number: 863288-34-0
EINECS:206-141-6
Molecular Formula: C152H252N44O42
Refractive index: 1.644
Density: 1.45

 

HGH will help you:

Pack on more muscle, by improving the rate at which your natural cell replacement takes place.

Enhance recovery from strenuous exercise and from sports and other injuries by promoting regeneration of muscles.

Repair injuries incurred in sports, exercise, and work faster.

Lose fat, because HGH stimulates the breakdown of fats in the body, especially in combination with steroids.

In particular, lose that dangerous fat around the abdomen.

Strengthen your immune system, meaning less downtime at work and play from colds, coughs and minor ailments.

Improve your athletic and personal performance, giving you greater stamina, and a greater ability to work and play harder and longer.

 

 

Payment and delivery
Payment Terms: , MoneyGram, T/T, Bank Transfer;Bitcoin
Delivery time: 1-3 working days after confirming the payment
Delivery  Door to Door,safety gurantee
4 big express: DHL, TNT, FedEx, UPS,
Post: HKEMS, , etc.
Bulk qty for special line, guarantee safety
Packaging Details: If customer no special request, normally and safe pack.
Supply Ability: Bulk qty in stock

 

Detailed Description

Quality

1. High quality and competitive price.

2. All purity> 99%.

3. We are a manufacturer and can provide high-quality products at ex-factory prices.

Delivery

1. The package will be sent out within 24 hours of receiving the remittance.

2. Safe and prudent transportation method for you to choose.

3. Customs pass rate> 99%.

Service

1. Professional service and rich experience make customers feel at ease, sufficient inventory and fast delivery meet their needs.

2. Can provide NMR, HPLC, and COA.

3. Welcome to order samples.

After-sales

1. Communicate face to face via phone/WeChat/Whatsapp/skype. We are experts and your friends!

2. Market feedback and product feedback will be greatly appreciated. It is our responsibility to meet customer requirements.

3. Hubei Cangsheng Trading Co., Ltd. exports the goods to many countries and regions at reasonable prices. If you are interested, please do not hesitate to send us an inquiry!

 

 

 

 

 

Other products of this supplier

Hubei Cangsheng Trading Co., Ltd.Tel:+86 19971437628  Email:doublewin-lina@nandrolonesteroid.com
 Address:Kenxin Road, People's Courtyard Farm Management Area, Jianli County, Jingzhou City, Hubei Province,434000